PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe5G437300.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family TALE
Protein Properties Length: 604aa    MW: 68315.9 Da    PI: 7.0992
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe5G437300.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.26.4e-093754121954
                        HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
           Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                        Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  Aqcoe5G437300.2.p 375 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 412
                        564459******************************88 PP

2BELL108.54e-35239307472
               BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                        +lqk+ka+Lls+leeVd+rYkqy++q++ v+ssFeav+g g+a  Y +lA+ka+SrhFr L+dai+ q+
  Aqcoe5G437300.2.p 239 DLQKRKARLLSMLEEVDRRYKQYCNQMKSVVSSFEAVVGTGAASGYSALASKAMSRHFRTLRDAIVAQL 307
                        79****************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.4E-56172305IPR006563POX domain
PfamPF075261.7E-44178304IPR006563POX domain
PROSITE profilePS5007112.098353416IPR001356Homeobox domain
CDDcd000863.79E-11356417No hitNo description
SMARTSM003895.0E-9356420IPR001356Homeobox domain
SuperFamilySSF466892.57E-17357422IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-27359422IPR009057Homeodomain-like
PfamPF059207.9E-18373412IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 604 aa     Download sequence    Send to blast
MAGQSRQQGE MGSFGTHFLN QIPNFESNPE LYNLTTGMEM LTTFPSKNRD SSSSNSAVMW  60
KNNSFFSKQH QADQFKQPDF SVGFSGASEN LSWVVDGSSM RSIDYSCDER PNSTQGLSLS  120
LCSNELRGQT SHQQQQDGFF GRSISFQNQT PAEEEHILQD GFMGSKATAG SSNQHFQLKN  180
SVYFTPAQEL LNEFCSLGAK LNDQKKKKKP QKTNQWEEEN GLGSSRNKQP SLNSLDLLDL  240
QKRKARLLSM LEEVDRRYKQ YCNQMKSVVS SFEAVVGTGA ASGYSALASK AMSRHFRTLR  300
DAIVAQLKAT KKAMGEKDPI APGTTKGETP RLRLLDQTLR QQKAFQQMNM MENHPWRPQR  360
GLPDRSVSIL RAWLFEHFLH PYPSDVDKHI LARQTGLSRS QVSNWFINAR VRLWKPMVEE  420
MYLEETKEQD NFASLDRVTS LDENCRPYEN HSPNLNHQED QKPTPNQLVR NDSESLSSII  480
NNPEPKNGRH HNLHQQQQQH RRQLGKDPET FGVVDLDFSS YAASGVHQNF SNGVSLTLGL  540
QQHGESGPMN LSFSPASQHS LFFPRDHMED CEQVQYSFLD GGEGENLPYR NLMSAQLLHD  600
YAG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-15362420563Homeobox protein Meis2
3k2a_B2e-15362420563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002279230.20.0PREDICTED: homeobox protein BEL1 homolog
SwissprotQ388971e-130BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLF6HUM60.0F6HUM6_VITVI; Putative uncharacterized protein
STRINGVIT_02s0025g00200.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-119TALE family protein